SCOPe 2.03: Domain d4i83b_: 4i83 B:

Lineage for d4i83b_ (4i83 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (19 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:272831] [193287] (2 PDB entries)

8. Domain d4i83b_: 4i83 B: [202586]
   automated match to d4i83c_

Details for d4i83b_

PDB Entry: 4i83, 2.6 Å

PDB Description: crystal structure of (3r)-hydroxymyristoyl-acp dehydratase from neisseria meningitidis fam18

PDB Compounds: (B:) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

SCOPe Domain Sequences for d4i83b_:

Sequence; same for both SEQRES and ATOM records:

>d4i83b_ d.38.1.0 (B:) automated matches {Neisseria meningitidis [TaxId: 272831]}
vqlpieakdiqkliphrypflqldritafepmktltaiknvsinepqfqghfpdlpvmpg
vliieamaqacgtlailseggrkeneffffagidearfkrqvipgdqlvfevelltsrrg
igkfnavakvdgqvaveaiimcak

Timeline for d4i83b_:

• d4i83b_ is new in SCOPe 2.03-stable
  
• d4i83b_ appears in SCOPe 2.04
  
• d4i83b_ appears in the current release, SCOPe 2.08