![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family) ![]() |
![]() | Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein) |
![]() | Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species) |
![]() | Species Mastigocladus laminosus [TaxId:83541] [103434] (2 PDB entries) |
![]() | Domain d4i7zc3: 4i7z C:250-288 [202585] Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc1, d4i7zc2, d4i7ze_, d4i7zf_, d4i7zg_, d4i7zh_ automated match to d1vf5c3 complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq |
PDB Entry: 4i7z (more details), 2.8 Å
SCOPe Domain Sequences for d4i7zc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7zc3 f.23.23.1 (C:250-288) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]} qdpnrvkwmiaficlvmlaqlmlilkkkqvekvqaaemn
Timeline for d4i7zc3: