Lineage for d4i7zc1 (4i7z C:1-169,C:232-249)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2378264Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 2378265Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 2378266Protein Cytochrome f, large domain [49443] (5 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 2378283Species Mastigocladus laminosus [TaxId:83541] [101556] (2 PDB entries)
  8. 2378284Domain d4i7zc1: 4i7z C:1-169,C:232-249 [202583]
    Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7zc2, d4i7zc3, d4i7ze_, d4i7zf_, d4i7zg_, d4i7zh_
    automated match to d1vf5c1
    complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq

Details for d4i7zc1

PDB Entry: 4i7z (more details), 2.8 Å

PDB Description: crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
PDB Compounds: (C:) Apocytochrome f

SCOPe Domain Sequences for d4i7zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i7zc1 b.2.6.1 (C:1-169,C:232-249) Cytochrome f, large domain {Mastigocladus laminosus [TaxId: 83541]}
ypfwaqqtypptpreptgrivcanchlaakpaevevpqsvlpdtvfkavvkipydtklqq
vaadgskvglnvgavlmlpegfkiapeeripeelkkevgdvyfqpykegqdnvllvgplp
geqyqeivfpvlspnpttdknihfgkyaihlganrgrgqiyptgeksnnXtnnpnvggfg
qddteivl

SCOPe Domain Coordinates for d4i7zc1:

Click to download the PDB-style file with coordinates for d4i7zc1.
(The format of our PDB-style files is described here.)

Timeline for d4i7zc1: