Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species) |
Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries) |
Domain d4i7fa2: 4i7f A:430-552 [202582] Other proteins in same PDB: d4i7fa1, d4i7fb_ automated match to d1c1ba1 complexed with cl, mg, nve, so4 |
PDB Entry: 4i7f (more details), 2.5 Å
SCOPe Domain Sequences for d4i7fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7fa2 c.55.3.1 (A:430-552) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd klv
Timeline for d4i7fa2: