SCOPe 2.07: Domain d4i7fa2: 4i7f A:430-552

Lineage for d4i7fa2 (4i7f A:430-552)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries)

8. Domain d4i7fa2: 4i7f A:430-552 [202582]
   Other proteins in same PDB: d4i7fa1, d4i7fb_
   automated match to d1c1ba1
   complexed with cl, mg, nve, so4

Details for d4i7fa2

PDB Entry: 4i7f, 2.5 Å

PDB Description: hiv-1 reverse transcriptase in complex with a phosphonate analog of nevirapine

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d4i7fa2:

Sequence; same for both SEQRES and ATOM records:

>d4i7fa2 c.55.3.1 (A:430-552) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

Timeline for d4i7fa2:

• d4i7fa2 first appeared in SCOPe 2.03
  
• d4i7fa2 appears in SCOPe 2.06
  
• d4i7fa2 appears in the current release, SCOPe 2.08