Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein HIV-1 reverse transcriptase [56689] (3 species) |
Species Hiv-1 m:b_hxb2r [TaxId:11706] [190022] (22 PDB entries) |
Domain d4i7fa1: 4i7f A:1-429 [202581] Other proteins in same PDB: d4i7fa2 automated match to d1c1ba2 complexed with cl, mg, nve, so4 |
PDB Entry: 4i7f (more details), 2.5 Å
SCOPe Domain Sequences for d4i7fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7fa1 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Hiv-1 m:b_hxb2r [TaxId: 11706]} pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp plvklwyql
Timeline for d4i7fa1: