Lineage for d4i6na1 (4i6n A:2-225)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927829Species Trichinella spiralis [TaxId:6334] [197187] (1 PDB entry)
  8. 2927830Domain d4i6na1: 4i6n A:2-225 [202577]
    Other proteins in same PDB: d4i6na2, d4i6nb_, d4i6nc2, d4i6nd_
    automated match to d4i6nc_
    complexed with dtt, gve, na

Details for d4i6na1

PDB Entry: 4i6n (more details), 1.7 Å

PDB Description: Crystal structure of Trichinella spiralis UCH37 catalytic domain bound to Ubiquitin vinyl methyl ester
PDB Compounds: (A:) Ubiquitin carboxyl-hydrolase

SCOPe Domain Sequences for d4i6na1:

Sequence, based on SEQRES records: (download)

>d4i6na1 d.3.1.0 (A:2-225) automated matches {Trichinella spiralis [TaxId: 6334]}
aegnwcliesdpgiftemihgfgctglqveelvvldesiehlkpihgfiflfrwlkkemr
kevddspqtctdvyfsqqviqnacasqalinlllncdhpdvdlgptlkefkdftydldsa
srglcltnsekiravhnsfgrqqlfeiddqqkldeedvfhfvtyvpvndgvyeldglraa
plrlgtvasdgdwtevaikaikekiknygesevrfnlmavisdq

Sequence, based on observed residues (ATOM records): (download)

>d4i6na1 d.3.1.0 (A:2-225) automated matches {Trichinella spiralis [TaxId: 6334]}
aegnwcliesdpgiftemihgfgctglqveelvvldesiehlkpihgfiflfrwlkkemr
kevddspqtctdvyfsqqviqnacasqalinlllncdhpdvdlgptlkefkdftydldsa
srglcltnsekiravhnsfgqkldeedvfhfvtyvpvndgvyeldglraaplrlgtvasd
gdwtevaikaikekiknygesevrfnlmavisdq

SCOPe Domain Coordinates for d4i6na1:

Click to download the PDB-style file with coordinates for d4i6na1.
(The format of our PDB-style files is described here.)

Timeline for d4i6na1: