SCOPe 2.07: Domain d4i6na1: 4i6n A:2-225

Lineage for d4i6na1 (4i6n A:2-225)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (21 species)
   not a true protein

7. Species Trichinella spiralis [TaxId:6334] [197187] (1 PDB entry)

8. Domain d4i6na1: 4i6n A:2-225 [202577]
   Other proteins in same PDB: d4i6na2, d4i6nb_, d4i6nc2, d4i6nd_
   automated match to d4i6nc_
   complexed with dtt, gve, na

Details for d4i6na1

PDB Entry: 4i6n, 1.7 Å

PDB Description: Crystal structure of Trichinella spiralis UCH37 catalytic domain bound to Ubiquitin vinyl methyl ester

PDB Compounds: (A:) Ubiquitin carboxyl-hydrolase

SCOPe Domain Sequences for d4i6na1:

Sequence, based on SEQRES records:

>d4i6na1 d.3.1.0 (A:2-225) automated matches {Trichinella spiralis [TaxId: 6334]}
aegnwcliesdpgiftemihgfgctglqveelvvldesiehlkpihgfiflfrwlkkemr
kevddspqtctdvyfsqqviqnacasqalinlllncdhpdvdlgptlkefkdftydldsa
srglcltnsekiravhnsfgrqqlfeiddqqkldeedvfhfvtyvpvndgvyeldglraa
plrlgtvasdgdwtevaikaikekiknygesevrfnlmavisdq

Sequence, based on observed residues (ATOM records):

>d4i6na1 d.3.1.0 (A:2-225) automated matches {Trichinella spiralis [TaxId: 6334]}
aegnwcliesdpgiftemihgfgctglqveelvvldesiehlkpihgfiflfrwlkkemr
kevddspqtctdvyfsqqviqnacasqalinlllncdhpdvdlgptlkefkdftydldsa
srglcltnsekiravhnsfgqkldeedvfhfvtyvpvndgvyeldglraaplrlgtvasd
gdwtevaikaikekiknygesevrfnlmavisdq

Timeline for d4i6na1:

• d4i6na1 first appeared in SCOPe 2.03, called d4i6na_
  
• d4i6na1 appears in SCOPe 2.06