Lineage for d4i5ld1 (4i5l D:9-589)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2332829Family a.118.1.2: HEAT repeat [48385] (3 protein domains)
    Pfam PF02985
  6. 2332830Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (2 species)
  7. 2332831Species Human (Homo sapiens) [TaxId:9606] [48387] (12 PDB entries)
  8. 2332841Domain d4i5ld1: 4i5l D:9-589 [202575]
    Other proteins in same PDB: d4i5la2, d4i5lc_, d4i5ld2, d4i5lf_
    automated match to d4i5la_
    complexed with ca, mli, mn, peg

Details for d4i5ld1

PDB Entry: 4i5l (more details), 2.43 Å

PDB Description: structural mechanism of trimeric pp2a holoenzyme involving pr70: insight for cdc6 dephosphorylation
PDB Compounds: (D:) Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

SCOPe Domain Sequences for d4i5ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5ld1 a.118.1.2 (D:9-589) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}
slypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevlla
laeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahf
vplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaask
lgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptl
rqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvke
fcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllpl
flaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieymp
llagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvla
msgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkig
pildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla

SCOPe Domain Coordinates for d4i5ld1:

Click to download the PDB-style file with coordinates for d4i5ld1.
(The format of our PDB-style files is described here.)

Timeline for d4i5ld1: