SCOPe 2.03: Domain d1a6vh_: 1a6v H:

Lineage for d1a6vh_ (1a6v H:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1a6vh_: 1a6v H: [20257]
   Other proteins in same PDB: d1a6vl_, d1a6vm_, d1a6vn_
   part of Fv B1-8; this domain is identical to the N-terminal domain of scFv 1NQB
   complexed with npc

Details for d1a6vh_

PDB Entry: 1a6v, 1.8 Å

PDB Description: B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound

PDB Compounds: (H:) b1-8 fv (heavy chain)

SCOPe Domain Sequences for d1a6vh_:

Sequence; same for both SEQRES and ATOM records:

>d1a6vh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtv

Timeline for d1a6vh_:

• d1a6vh_ first appeared (with stable ids) in SCOP 1.55
  
• d1a6vh_ appears in SCOPe 2.02
  
• d1a6vh_ appears in SCOPe 2.04
  
• d1a6vh_ appears in the current release, SCOPe 2.08