| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries) |
| Domain d4i5ee1: 4i5e E:2-249 [202557] Other proteins in same PDB: d4i5ea2, d4i5eb2, d4i5ec2, d4i5ed2, d4i5ee2, d4i5ef2, d4i5eg2, d4i5eh2 automated match to d4i5ea_ complexed with gol, nap |
PDB Entry: 4i5e (more details), 2.8 Å
SCOPe Domain Sequences for d4i5ee1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5ee1 c.2.1.0 (E:2-249) automated matches {Ralstonia sp. [TaxId: 517192]}
yrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkadv
tkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvqk
alpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavspg
aidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagielf
vdggltqv
Timeline for d4i5ee1: