SCOPe 2.06: Domain d4i5eb1: 4i5e B:2-249

Lineage for d4i5eb1 (4i5e B:2-249)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Ralstonia sp. [TaxId:517192] [197315] (6 PDB entries)

8. Domain d4i5eb1: 4i5e B:2-249 [202554]
   Other proteins in same PDB: d4i5ea2, d4i5eb2, d4i5ec2, d4i5ed2, d4i5ee2, d4i5ef2, d4i5eg2, d4i5eh2
   automated match to d4i5ea_
   complexed with gol, nap

Details for d4i5eb1

PDB Entry: 4i5e, 2.8 Å

PDB Description: Crystal structure of Ralstonia sp. alcohol dehydrogenase in complex with NADP+

PDB Compounds: (B:) Alclohol dehydrogenase/short-chain dehydrogenase

SCOPe Domain Sequences for d4i5eb1:

Sequence; same for both SEQRES and ATOM records:

>d4i5eb1 c.2.1.0 (B:2-249) automated matches {Ralstonia sp. [TaxId: 517192]}
yrllnktavitggnsgiglatakrfvaegayvfivgrrrkeleqaaaeigrnvtavkadv
tkledldrlyaivreqrgsidvlfansgaieqktleeitpehydrtfdvnvrgliftvqk
alpllrdggsviltssvagvlglqahdtysaakaavrslartwttelkgrsirvnavspg
aidtpiienqvstqeeadelrakfaaatplgrvgrpeelaaavlflasddssyvagielf
vdggltqv

Timeline for d4i5eb1:

• d4i5eb1 first appeared in SCOPe 2.03, called d4i5eb_
  
• d4i5eb1 was called d4i5eb_ in SCOPe 2.05
  
• d4i5eb1 appears in SCOPe 2.07
  
• d4i5eb1 appears in the current release, SCOPe 2.08