Lineage for d4i52d_ (4i52 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462639Species Synechocystis sp. [TaxId:1111708] [197025] (3 PDB entries)
  8. 2462658Domain d4i52d_: 4i52 D: [202548]
    automated match to d4i4za_
    complexed with 1ha, cl

Details for d4i52d_

PDB Entry: 4i52 (more details), 2.35 Å

PDB Description: scMenB im complex with 1-hydroxy-2-naphthoyl-CoA
PDB Compounds: (D:) naphthoate synthase

SCOPe Domain Sequences for d4i52d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i52d_ c.14.1.0 (D:) automated matches {Synechocystis sp. [TaxId: 1111708]}
mdwhiakhyddilyykaggiakivinrphkrnafrpqtvfelydafcnarednrigvvll
tgagphsdgkyafcsggdqsvrgeggyiddqgtprlnvldlqrlirsmpkvvialvagya
iggghvlhlvcdltiaadnaifgqtgpkvgsfdggfgssylarivgqkkareiwylcrqy
saqeaermgmvntvvpvdrleeegiqwakeilsksplairclkaafnadcdgqaglqela
gnatllyymteegsegkqaflekrppdfsqypwlp

SCOPe Domain Coordinates for d4i52d_:

Click to download the PDB-style file with coordinates for d4i52d_.
(The format of our PDB-style files is described here.)

Timeline for d4i52d_: