Lineage for d4i3zd2 (4i3z D:310-431)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331672Protein automated matches [227027] (3 species)
    not a true protein
  7. 2331767Species Mouse (Mus musculus) [TaxId:10090] [226547] (2 PDB entries)
  8. 2331775Domain d4i3zd2: 4i3z D:310-431 [202537]
    Other proteins in same PDB: d4i3za_, d4i3zc_
    automated match to d1oiub2
    complexed with adp, cl, gol, mg

Details for d4i3zd2

PDB Entry: 4i3z (more details), 2.05 Å

PDB Description: structure of pcdk2/cyclina bound to adp and 2 magnesium ions
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4i3zd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i3zd2 a.74.1.1 (D:310-431) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tvnqfltqyflhlqpanckveslamflgelslidadpylkylpsliagaafhlalytvtg
qswpeslaqqtgytleslkpclvdlhqtylkapqhaqqsirekykhskyhsvsllnppet
ls

SCOPe Domain Coordinates for d4i3zd2:

Click to download the PDB-style file with coordinates for d4i3zd2.
(The format of our PDB-style files is described here.)

Timeline for d4i3zd2: