![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein automated matches [227027] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [226547] (2 PDB entries) |
![]() | Domain d4i3zb1: 4i3z B:175-309 [202534] Other proteins in same PDB: d4i3za_, d4i3zc_ automated match to d1finb1 complexed with adp, cl, gol, mg |
PDB Entry: 4i3z (more details), 2.05 Å
SCOPe Domain Sequences for d4i3zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i3zb1 a.74.1.1 (B:175-309) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vpdyqedihtylremevkckpkvgymkrqpditnsmrailvdwlvevgeeyklqnetlhl avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtyskkqvlrm ehlvlkvlafdlaap
Timeline for d4i3zb1:
![]() Domains from other chains: (mouse over for more information) d4i3za_, d4i3zc_, d4i3zd1, d4i3zd2 |