Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein automated matches [190295] (5 species) not a true protein |
Species Eel (Anguilla japonica) [TaxId:7937] [197394] (3 PDB entries) |
Domain d4i3db_: 4i3d B: [202531] automated match to d4i3da_ complexed with bla; mutant |
PDB Entry: 4i3d (more details), 2.3 Å
SCOPe Domain Sequences for d4i3db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i3db_ b.60.1.2 (B:) automated matches {Eel (Anguilla japonica) [TaxId: 7937]} mvekfvgtwkiadshnfgeylkaigapkelsdggdattptlyisqkdgdkmtvkieagpp tfldtqvkfklgeefdefpsdrrkgvksvvnlvgeklvyvqkwdgkettyvreikdgklv vtltmgdvvavrsyrrate
Timeline for d4i3db_: