SCOPe 2.05: Domain d4i3bc_: 4i3b C:

Lineage for d4i3bc_ (4i3b C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Eel (Anguilla japonica) [TaxId:7937] [197394] (3 PDB entries)

8. Domain d4i3bc_: 4i3b C: [202526]
   automated match to d4i3ba_
   complexed with bla, peg

Details for d4i3bc_

PDB Entry: 4i3b, 1.2 Å

PDB Description: Crystal structure of fluorescent protein UnaG wild type

PDB Compounds: (C:) Fatty acid binding protein-like

SCOPe Domain Sequences for d4i3bc_:

Sequence; same for both SEQRES and ATOM records:

>d4i3bc_ b.60.1.2 (C:) automated matches {Eel (Anguilla japonica) [TaxId: 7937]}
mvekfvgtwkiadshnfgeylkaigapkelsdggdattptlyisqkdgdkmtvkiengpp
tfldtqvkfklgeefdefpsdrrkgvksvvnlvgeklvyvqkwdgkettyvreikdgklv
vtltmgdvvavrsyrrat

Timeline for d4i3bc_:

• d4i3bc_ first appeared in SCOPe 2.03
  
• d4i3bc_ appears in SCOPe 2.04
  
• d4i3bc_ appears in SCOPe 2.06
  
• d4i3bc_ appears in the current release, SCOPe 2.08