Lineage for d4i1oe1 (4i1o E:4-174)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868500Domain d4i1oe1: 4i1o E:4-174 [202523]
    Other proteins in same PDB: d4i1oa2, d4i1oc2, d4i1oe2, d4i1og2
    automated match to d4i1og_
    complexed with bef, gdp, mg, peg

Details for d4i1oe1

PDB Entry: 4i1o (more details), 2.7 Å

PDB Description: Crystal structure of the Legionella pneumophila GAP domain of LepB in complex with Rab1b bound to GDP and BeF3
PDB Compounds: (E:) Ras-related protein Rab-1B

SCOPe Domain Sequences for d4i1oe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i1oe1 c.37.1.8 (E:4-174) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwd
tagqerfrtitssyyrgahgiivvydvtdqesyanvkqwlqeidryasenvnkllvgnks
dlttkkvvdnttakefadslgipfletsaknatnveqafmtmaaeikkrmg

SCOPe Domain Coordinates for d4i1oe1:

Click to download the PDB-style file with coordinates for d4i1oe1.
(The format of our PDB-style files is described here.)

Timeline for d4i1oe1: