Lineage for d4hzec_ (4hze C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2873863Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2873884Protein Arginase [52770] (5 species)
  7. 2873996Species Human (Homo sapiens), isoform II, mitochondrial [TaxId:9606] [102412] (9 PDB entries)
  8. 2873999Domain d4hzec_: 4hze C: [202521]
    automated match to d1pq3a_
    complexed with ben, bme, mn, x7a

Details for d4hzec_

PDB Entry: 4hze (more details), 1.6 Å

PDB Description: crystal structure of human arginase-2 complexed with inhibitor 9
PDB Compounds: (C:) Arginase-2, mitochondrial

SCOPe Domain Sequences for d4hzec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hzec_ c.42.1.1 (C:) Arginase {Human (Homo sapiens), isoform II, mitochondrial [TaxId: 9606]}
hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
gqtreg

SCOPe Domain Coordinates for d4hzec_:

Click to download the PDB-style file with coordinates for d4hzec_.
(The format of our PDB-style files is described here.)

Timeline for d4hzec_: