Lineage for d4hyyd_ (4hyy D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112131Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 protein domains)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2112689Protein automated matches [190393] (10 species)
    not a true protein
  7. 2112725Species Human (Homo sapiens) [TaxId:9606] [196788] (1 PDB entry)
  8. 2112729Domain d4hyyd_: 4hyy D: [202519]
    automated match to d4hyya_

Details for d4hyyd_

PDB Entry: 4hyy (more details), 2.6 Å

PDB Description: Filament of octameric rings of DMC1 recombinase from Homo sapiens
PDB Compounds: (D:) Meiotic recombination protein DMC1/LIM15 homolog

SCOPe Domain Sequences for d4hyyd_:

Sequence, based on SEQRES records: (download)

>d4hyyd_ c.37.1.11 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvta
qlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmell
dyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynva
vfvtnqmtadpgatmtfqadpkkpigghilahasttrislrkgrgelriakiydspempe
neatfaitaggigda

Sequence, based on observed residues (ATOM records): (download)

>d4hyyd_ c.37.1.11 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gfltafeysekrkmvfhittgsqefdkllgggiesmaiteafgefrtgktqlshtlcvta
qlpgaggypggkiifidtentfrpdrlrdiadrfnvdhdavldnvlyaraytsehqmell
dyvaakfheeagifklliidsimalfrvdfsgrgelaerqqklaqmlsrlqkiseeynva
vfvtnqmtkpigghilahasttrislrkgrgelriakiydspempeneatfaitaggigd
a

SCOPe Domain Coordinates for d4hyyd_:

Click to download the PDB-style file with coordinates for d4hyyd_.
(The format of our PDB-style files is described here.)

Timeline for d4hyyd_: