Lineage for d4hy0e_ (4hy0 E:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707316Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1707317Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 1707318Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1707452Protein automated matches [190700] (1 species)
    not a true protein
  7. 1707453Species Human (Homo sapiens) [TaxId:9606] [187840] (25 PDB entries)
  8. 1707502Domain d4hy0e_: 4hy0 E: [202513]
    automated match to d4hy0a_
    complexed with 1aq, zn

Details for d4hy0e_

PDB Entry: 4hy0 (more details), 2.84 Å

PDB Description: Crystal structure of XIAP BIR3 with T3256336
PDB Compounds: (E:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d4hy0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hy0e_ g.52.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
edpweqhakwypgckylleqkgqeyinnihlthsle

SCOPe Domain Coordinates for d4hy0e_:

Click to download the PDB-style file with coordinates for d4hy0e_.
(The format of our PDB-style files is described here.)

Timeline for d4hy0e_: