| Class g: Small proteins [56992] (90 folds) |
| Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
| Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
| Protein automated matches [190700] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187840] (21 PDB entries) |
| Domain d4hy0d_: 4hy0 D: [202512] automated match to d4hy0a_ complexed with 1aq, zn |
PDB Entry: 4hy0 (more details), 2.84 Å
SCOPe Domain Sequences for d4hy0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hy0d_ g.52.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkps
edpweqhakwypgckylleqkgqeyinnihlthsleec
Timeline for d4hy0d_: