SCOP 1.57: Domain d1a6tc1: 1a6t C:1-107

Lineage for d1a6tc1 (1a6t C:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab Mab1-IA (mouse), kappa L chain [48852] (1 PDB entry)

8. Domain d1a6tc1: 1a6t C:1-107 [20250]
   Other proteins in same PDB: d1a6ta2, d1a6tb2, d1a6tc2, d1a6td2

Details for d1a6tc1

PDB Entry: 1a6t, 2.7 Å

PDB Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site

SCOP Domain Sequences for d1a6tc1:

Sequence; same for both SEQRES and ATOM records:

>d1a6tc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab Mab1-IA (mouse), kappa L chain}
qsvlsqspailsaspgekvimtcspsssvsymqwyqqkpgsspkpwiystsnlasgvpgr
fsgggsgtsfsltisgveaedaatyycqqysshpltfgggtklelk

Timeline for d1a6tc1:

• d1a6tc1 first appeared (with stable ids) in SCOP 1.55
  
• d1a6tc1 appears in SCOP 1.59
  
• d1a6tc1 appears in the current release, SCOPe 2.08