Lineage for d4hw3f_ (4hw3 F:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1454901Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1454943Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1454944Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1455056Protein automated matches [190236] (2 species)
    not a true protein
  7. 1455057Species Human (Homo sapiens) [TaxId:9606] [188722] (29 PDB entries)
  8. 1455110Domain d4hw3f_: 4hw3 F: [202497]
    automated match to d4hw3k_
    complexed with 19g

Details for d4hw3f_

PDB Entry: 4hw3 (more details), 2.4 Å

PDB Description: Discovery of potent Mcl-1 inhibitors using fragment-based methods and structure-based design
PDB Compounds: (F:) Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d4hw3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hw3f_ f.1.4.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdelyrqsleiisrylreqatgakdtkpmgrsgatsrkaletlrrvgdgvqrnhetafqg
mlrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepl
aesitdvlvrtkrdwlvkqrgwdgfveffhv

SCOPe Domain Coordinates for d4hw3f_:

Click to download the PDB-style file with coordinates for d4hw3f_.
(The format of our PDB-style files is described here.)

Timeline for d4hw3f_: