Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab Mab1-IA (mouse), kappa L chain [48852] (1 PDB entry) neutralizes human rhinovirus 14 |
Domain d1a6tb1: 1a6t B:1-113 [20249] Other proteins in same PDB: d1a6ta2, d1a6tb2, d1a6tc2, d1a6td2 |
PDB Entry: 1a6t (more details), 2.7 Å
SCOP Domain Sequences for d1a6tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6tb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Fab Mab1-IA (mouse), kappa L chain} evqlqqsgpdlvkpgasvkisckasgysfstyymhwvkqshgkslewigrvdpdnggtsf nqkfkgkailtvdkssstaymelgsltsedsavyycarrddyyfdfwgqgtsltvss
Timeline for d1a6tb1: