SCOPe 2.07: Domain d4hv8a2: 4hv8 A:182-277

Lineage for d4hv8a2 (4hv8 A:182-277)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d4hv8a2: 4hv8 A:182-277 [202488]
   Other proteins in same PDB: d4hv8a1, d4hv8b1, d4hv8b2, d4hv8c1, d4hv8d_
   automated match to d1kjva1
   complexed with so4

Details for d4hv8a2

PDB Entry: 4hv8, 2 Å

PDB Description: crystal structure of h2db-h155a-npm6i

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4hv8a2:

Sequence; same for both SEQRES and ATOM records:

>d4hv8a2 b.1.1.2 (A:182-277) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwepp

Timeline for d4hv8a2:

• d4hv8a2 first appeared in SCOPe 2.03
  
• d4hv8a2 appears in SCOPe 2.06
  
• d4hv8a2 appears in the current release, SCOPe 2.08