Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus) [TaxId:10090] [226600] (3 PDB entries) |
Domain d4hv8a1: 4hv8 A:2-181 [202487] Other proteins in same PDB: d4hv8a2, d4hv8b1, d4hv8b2, d4hv8c2, d4hv8d_ automated match to d1kjva2 complexed with so4 |
PDB Entry: 4hv8 (more details), 2 Å
SCOPe Domain Sequences for d4hv8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hv8a1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]} phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr dyialnedlktwtaadmaaqitrrkweqsgaaeaykaylegecvewlhrylkngnatllr
Timeline for d4hv8a1: