Lineage for d4hv8a1 (4hv8 A:2-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545061Species Mouse (Mus musculus) [TaxId:10090] [226600] (3 PDB entries)
  8. 2545062Domain d4hv8a1: 4hv8 A:2-181 [202487]
    Other proteins in same PDB: d4hv8a2, d4hv8b1, d4hv8b2, d4hv8c2, d4hv8d_
    automated match to d1kjva2
    complexed with so4

Details for d4hv8a1

PDB Entry: 4hv8 (more details), 2 Å

PDB Description: crystal structure of h2db-h155a-npm6i
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4hv8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hv8a1 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaeaykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d4hv8a1:

Click to download the PDB-style file with coordinates for d4hv8a1.
(The format of our PDB-style files is described here.)

Timeline for d4hv8a1: