Lineage for d4huxa2 (4hux A:182-276)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358143Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2358446Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2358546Domain d4huxa2: 4hux A:182-276 [202486]
    Other proteins in same PDB: d4huxa1, d4huxb_
    automated match to d1kjva1
    complexed with act, gol

Details for d4huxa2

PDB Entry: 4hux (more details), 2.2 Å

PDB Description: crystal structure of h2db-h155a-np
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4huxa2:

Sequence, based on SEQRES records: (download)

>d4huxa2 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Sequence, based on observed residues (ATOM records): (download)

>d4huxa2 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplqnytcrvyheglpepltlrwep

SCOPe Domain Coordinates for d4huxa2:

Click to download the PDB-style file with coordinates for d4huxa2.
(The format of our PDB-style files is described here.)

Timeline for d4huxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4huxa1
View in 3D
Domains from other chains:
(mouse over for more information)
d4huxb_