Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus) [TaxId:10090] [226600] (3 PDB entries) |
Domain d4huxa1: 4hux A:1-181 [202485] Other proteins in same PDB: d4huxa2, d4huxb_ automated match to d1kjva2 complexed with act, gol |
PDB Entry: 4hux (more details), 2.2 Å
SCOPe Domain Sequences for d4huxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4huxa1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaeaykaylegecvewlhrylkngnatll r
Timeline for d4huxa1: