![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries) |
![]() | Domain d4huvd1: 4huv D:1-181 [202483] Other proteins in same PDB: d4huva2, d4huvb_, d4huvd2, d4huve_ automated match to d1jpfa2 complexed with so4 |
PDB Entry: 4huv (more details), 2.5 Å
SCOPe Domain Sequences for d4huvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4huvd1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll r
Timeline for d4huvd1:
![]() Domains from other chains: (mouse over for more information) d4huva1, d4huva2, d4huvb_, d4huve_ |