![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries) |
![]() | Domain d4huud1: 4huu D:2-181 [202479] Other proteins in same PDB: d4huua2, d4huub1, d4huub2, d4huud2, d4huue1, d4huue2 automated match to d1jpfa2 complexed with act |
PDB Entry: 4huu (more details), 2 Å
SCOPe Domain Sequences for d4huud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4huud1 d.19.1.1 (D:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
Timeline for d4huud1: