SCOPe 2.08: Domain d4huua1: 4huu A:1-181

Lineage for d4huua1 (4huu A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries)

8. Domain d4huua1: 4huu A:1-181 [202477]
   Other proteins in same PDB: d4huua2, d4huub1, d4huub2, d4huud2, d4huue1, d4huue2
   automated match to d1jpfa2
   complexed with act

Details for d4huua1

PDB Entry: 4huu, 2 Å

PDB Description: crystal structure of h2db-npm6i

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d4huua1:

Sequence; same for both SEQRES and ATOM records:

>d4huua1 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d4huua1:

• d4huua1 first appeared in SCOPe 2.03
  
• d4huua1 appears in SCOPe 2.07