SCOPe 2.02: Domain d1dsfh_: 1dsf H:

Lineage for d1dsfh_ (1dsf H:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (53 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1dsfh_: 1dsf H: [20247]
   Other proteins in same PDB: d1dsfl_
   part of anticancer Fv B1; disulfide-stabilized

Details for d1dsfh_

PDB Entry: 1dsf, 2 Å

PDB Description: the crystal structure of the disulfide-stabilized fv fragment of anticancer antibody b1: conformational influence of an engineered disulfide bond

PDB Compounds: (H:) anticancer antibody b1

SCOPe Domain Sequences for d1dsfh_:

Sequence; same for both SEQRES and ATOM records:

>d1dsfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
qlvesggglvkpggslklscaasgfifsdnymywvrqtpekclewvatisdggtyidysd
svkgrftisrdnaknnlylqmsslrsedtgmyycgrspiyydyapftywgqgtlvtvsa

Timeline for d1dsfh_:

• d1dsfh_ first appeared (with stable ids) in SCOP 1.55
  
• d1dsfh_ appears in SCOPe 2.01
  
• d1dsfh_ appears in SCOPe 2.03
  
• d1dsfh_ appears in the current release, SCOPe 2.08