SCOP 1.61: Domain d1dsfh_: 1dsf H:

Lineage for d1dsfh_ (1dsf H:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Anticancer Fv B1 (mouse) [48851] (1 PDB entry)

8. Domain d1dsfh_: 1dsf H: [20247]

Details for d1dsfh_

PDB Entry: 1dsf, 2.2 Å

PDB Description: the crystal structure of the disulfide-stabilized fv fragment of anticancer antibody b1: conformational influence of an engineered disulfide bond

SCOP Domain Sequences for d1dsfh_:

Sequence; same for both SEQRES and ATOM records:

>d1dsfh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anticancer Fv B1 (mouse)}
qlvesggglvkpggslklscaasgfifsdnymywvrqtpekclewvatisdggtyidysd
svkgrftisrdnaknnlylqmsslrsedtgmyycgrspiyydyapftywgqgtlvtvsa

Timeline for d1dsfh_:

• d1dsfh_ first appeared (with stable ids) in SCOP 1.55
  
• d1dsfh_ appears in SCOP 1.59
  
• d1dsfh_ appears in SCOP 1.63
  
• d1dsfh_ appears in the current release, SCOPe 2.08