![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Anticancer Fv B1 (mouse) [48851] (1 PDB entry) |
![]() | Domain d1dsfh_: 1dsf H: [20247] |
PDB Entry: 1dsf (more details), 2.2 Å
SCOP Domain Sequences for d1dsfh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dsfh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Anticancer Fv B1 (mouse)} qlvesggglvkpggslklscaasgfifsdnymywvrqtpekclewvatisdggtyidysd svkgrftisrdnaknnlylqmsslrsedtgmyycgrspiyydyapftywgqgtlvtvsa
Timeline for d1dsfh_: