Lineage for d1dsfh_ (1dsf H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740087Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2740092Domain d1dsfh_: 1dsf H: [20247]
    Other proteins in same PDB: d1dsfl_
    part of anticancer Fv B1; disulfide-stabilized

Details for d1dsfh_

PDB Entry: 1dsf (more details), 2 Å

PDB Description: the crystal structure of the disulfide-stabilized fv fragment of anticancer antibody b1: conformational influence of an engineered disulfide bond
PDB Compounds: (H:) anticancer antibody b1

SCOPe Domain Sequences for d1dsfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
qlvesggglvkpggslklscaasgfifsdnymywvrqtpekclewvatisdggtyidysd
svkgrftisrdnaknnlylqmsslrsedtgmyycgrspiyydyapftywgqgtlvtvsa

SCOPe Domain Coordinates for d1dsfh_:

Click to download the PDB-style file with coordinates for d1dsfh_.
(The format of our PDB-style files is described here.)

Timeline for d1dsfh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dsfl_