Lineage for d4hsxa_ (4hsx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686003Protein Dehaloperoxidase [46530] (1 species)
  7. 2686004Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)
  8. 2686011Domain d4hsxa_: 4hsx A: [202469]
    automated match to d4hsxb_
    complexed with bml, gol, hem, so4; mutant

Details for d4hsxa_

PDB Entry: 4hsx (more details), 1.12 Å

PDB Description: structure of the l100f mutant of dehaloperoxidase-hemoglobin a from amphitrite ornata with 4-bromophenol
PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d4hsxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hsxa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfekffvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d4hsxa_:

Click to download the PDB-style file with coordinates for d4hsxa_.
(The format of our PDB-style files is described here.)

Timeline for d4hsxa_: