SCOPe 2.08: Domain d4hsxa_: 4hsx A:

Lineage for d4hsxa_ (4hsx A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)

8. Domain d4hsxa_: 4hsx A: [202469]
   automated match to d4hsxb_
   complexed with bml, gol, hem, so4; mutant

Details for d4hsxa_

PDB Entry: 4hsx, 1.12 Å

PDB Description: structure of the l100f mutant of dehaloperoxidase-hemoglobin a from amphitrite ornata with 4-bromophenol

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d4hsxa_:

Sequence; same for both SEQRES and ATOM records:

>d4hsxa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfekffvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4hsxa_:

• d4hsxa_ first appeared in SCOPe 2.03
  
• d4hsxa_ appears in SCOPe 2.07