SCOPe 2.08: Domain d4hrwb1: 4hrw B:1-180

Lineage for d4hrwb1 (4hrw B:1-180)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Putative deaminase NE0047 [142833] (1 species)

7. Species Nitrosomonas europaea [TaxId:915] [142834] (12 PDB entries)
   Uniprot Q82Y41 1-189

8. Domain d4hrwb1: 4hrw B:1-180 [202465]
   Other proteins in same PDB: d4hrwb2
   automated match to d4hrwa_
   complexed with azg, zn

Details for d4hrwb1

PDB Entry: 4hrw, 2.43 Å

PDB Description: identification of function and mechanistic insights of guanine deaminase from nitrosomonas europaea

PDB Compounds: (B:) Cytidine and deoxycytidylate deaminase zinc-binding region

SCOPe Domain Sequences for d4hrwb1:

Sequence; same for both SEQRES and ATOM records:

>d4hrwb1 c.97.1.2 (B:1-180) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]}
mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll
iaagtnrvvpgrcsaahaailalslaqakldthdlsadglpacelvtsaepcvmcfgavi
wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac

Timeline for d4hrwb1:

• d4hrwb1 first appeared in SCOPe 2.03, called d4hrwb_
  
• d4hrwb1 appears in SCOPe 2.07