Lineage for d4hrth_ (4hrt H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1717805Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (31 PDB entries)
  8. 1717811Domain d4hrth_: 4hrt H: [202464]
    Other proteins in same PDB: d4hrta_, d4hrtc_, d4hrte_, d4hrtg_
    automated match to d4hrtb_
    complexed with hem, po4

Details for d4hrth_

PDB Entry: 4hrt (more details), 1.46 Å

PDB Description: Scapharca tetrameric hemoglobin, unliganded
PDB Compounds: (H:) Hemoglobin B chain

SCOPe Domain Sequences for d4hrth_:

Sequence, based on SEQRES records: (download)

>d4hrth_ a.1.1.2 (H:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
srvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvs
agkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgpl
rqtlkarmgnyfdedtvaawaslvavvqaal

Sequence, based on observed residues (ATOM records): (download)

>d4hrth_ a.1.1.2 (H:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
srvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvs
dnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgplrqt
lkarmgnyfdedtvaawaslvavvqaal

SCOPe Domain Coordinates for d4hrth_:

Click to download the PDB-style file with coordinates for d4hrth_.
(The format of our PDB-style files is described here.)

Timeline for d4hrth_: