SCOPe 2.08: Domain d4hrtf1: 4hrt F:3-151

Lineage for d4hrtf1 (4hrt F:3-151)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)

8. Domain d4hrtf1: 4hrt F:3-151 [202463]
   Other proteins in same PDB: d4hrta1, d4hrta2, d4hrtb2, d4hrtc1, d4hrtc2, d4hrtd2, d4hrte1, d4hrte2, d4hrtf2, d4hrtg1, d4hrtg2, d4hrth2
   automated match to d4hrtb_
   complexed with hem, po4

Details for d4hrtf1

PDB Entry: 4hrt, 1.46 Å

PDB Description: Scapharca tetrameric hemoglobin, unliganded

PDB Compounds: (F:) Hemoglobin B chain

SCOPe Domain Sequences for d4hrtf1:

Sequence; same for both SEQRES and ATOM records:

>d4hrtf1 a.1.1.2 (F:3-151) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
vaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvsag
kdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgplrq
tlkarmgnyfdedtvaawaslvavvqaal

Timeline for d4hrtf1:

• d4hrtf1 first appeared in SCOPe 2.03, called d4hrtf_
  
• d4hrtf1 appears in SCOPe 2.07