Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (40 species) not a true protein |
Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (31 PDB entries) |
Domain d4hrtd_: 4hrt D: [202462] Other proteins in same PDB: d4hrta_, d4hrtc_, d4hrte_, d4hrtg_ automated match to d4hrtb_ complexed with hem, po4 |
PDB Entry: 4hrt (more details), 1.46 Å
SCOPe Domain Sequences for d4hrtd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hrtd_ a.1.1.2 (D:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} srvaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvs agkdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgpl rqtlkarmgnyfdedtvaawaslvavvqaal
Timeline for d4hrtd_: