Lineage for d4hrtd1 (4hrt D:3-151)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688487Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)
  8. 2688489Domain d4hrtd1: 4hrt D:3-151 [202462]
    Other proteins in same PDB: d4hrta1, d4hrta2, d4hrtb2, d4hrtc1, d4hrtc2, d4hrtd2, d4hrte1, d4hrte2, d4hrtf2, d4hrtg1, d4hrtg2, d4hrth2
    automated match to d4hrtb_
    complexed with hem, po4

Details for d4hrtd1

PDB Entry: 4hrt (more details), 1.46 Å

PDB Description: Scapharca tetrameric hemoglobin, unliganded
PDB Compounds: (D:) Hemoglobin B chain

SCOPe Domain Sequences for d4hrtd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hrtd1 a.1.1.2 (D:3-151) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
vaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvsag
kdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgplrq
tlkarmgnyfdedtvaawaslvavvqaal

SCOPe Domain Coordinates for d4hrtd1:

Click to download the PDB-style file with coordinates for d4hrtd1.
(The format of our PDB-style files is described here.)

Timeline for d4hrtd1: