SCOP 1.69: Domain d1dsfl_: 1dsf L:

Lineage for d1dsfl_ (1dsf L:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1dsfl_: 1dsf L: [20246]
   Other proteins in same PDB: d1dsfh_
   part of anticancer Fv B1; disulfide-stabilized

Details for d1dsfl_

PDB Entry: 1dsf, 2.2 Å

PDB Description: the crystal structure of the disulfide-stabilized fv fragment of anticancer antibody b1: conformational influence of an engineered disulfide bond

SCOP Domain Sequences for d1dsfl_:

Sequence; same for both SEQRES and ATOM records:

>d1dsfl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslpvslgdqasiscrssqnlvhsdgktylhwflqkpgqsptlliykvsnrf
sgvpdrfsgsgsgtdfilkisrveaedlgvyfcsqsthvpltfgcgtklelk

Timeline for d1dsfl_:

• d1dsfl_ first appeared (with stable ids) in SCOP 1.55
  
• d1dsfl_ appears in SCOP 1.67
  
• d1dsfl_ appears in SCOP 1.71
  
• d1dsfl_ appears in the current release, SCOPe 2.08