SCOP 1.59: Domain d1dsfl_: 1dsf L:

Lineage for d1dsfl_ (1dsf L:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Anticancer Fv B1 (mouse) [48851] (1 PDB entry)

8. Domain d1dsfl_: 1dsf L: [20246]

Details for d1dsfl_

PDB Entry: 1dsf, 2.2 Å

PDB Description: the crystal structure of the disulfide-stabilized fv fragment of anticancer antibody b1: conformational influence of an engineered disulfide bond

SCOP Domain Sequences for d1dsfl_:

Sequence; same for both SEQRES and ATOM records:

>d1dsfl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Anticancer Fv B1 (mouse)}
dvvmtqtplslpvslgdqasiscrssqnlvhsdgktylhwflqkpgqsptlliykvsnrf
sgvpdrfsgsgsgtdfilkisrveaedlgvyfcsqsthvpltfgcgtklelk

Timeline for d1dsfl_:

• d1dsfl_ first appeared (with stable ids) in SCOP 1.55
  
• d1dsfl_ appears in SCOP 1.57
  
• d1dsfl_ appears in SCOP 1.61
  
• d1dsfl_ appears in the current release, SCOPe 2.08