SCOPe 2.06: Domain d4hr2a1: 4hr2 A:1-141

Lineage for d4hr2a1 (4hr2 A:1-141)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (18 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [193397] (3 PDB entries)

8. Domain d4hr2a1: 4hr2 A:1-141 [202456]
   Other proteins in same PDB: d4hr2a2
   automated match to d4hr2b_
   complexed with adp

Details for d4hr2a1

PDB Entry: 4hr2, 1.95 Å

PDB Description: Structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis bound to ADP

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4hr2a1:

Sequence; same for both SEQRES and ATOM records:

>d4hr2a1 d.58.6.1 (A:1-141) automated matches {Burkholderia thailandensis [TaxId: 271848]}
malertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhaerpff
kdlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgsd
apetarveiafffpemnvysr

Timeline for d4hr2a1:

• d4hr2a1 first appeared in SCOPe 2.03, called d4hr2a_
  
• d4hr2a1 was called d4hr2a_ in SCOPe 2.05
  
• d4hr2a1 appears in SCOPe 2.07
  
• d4hr2a1 appears in the current release, SCOPe 2.08