SCOPe 2.05: Domain d4hr2a_: 4hr2 A:

Lineage for d4hr2a_ (4hr2 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (15 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [193397] (3 PDB entries)

8. Domain d4hr2a_: 4hr2 A: [202456]
   automated match to d4hr2b_
   complexed with adp

Details for d4hr2a_

PDB Entry: 4hr2, 1.95 Å

PDB Description: Structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis bound to ADP

PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4hr2a_:

Sequence; same for both SEQRES and ATOM records:

>d4hr2a_ d.58.6.1 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
smalertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhaerpf
fkdlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgs
dapetarveiafffpemnvysr

Timeline for d4hr2a_:

• d4hr2a_ first appeared in SCOPe 2.03
  
• d4hr2a_ appears in SCOPe 2.04
  
• d4hr2a_ is called d4hr2a1 in SCOPe 2.06
  
• d4hr2a_ appears in the current release, SCOPe 2.08, called d4hr2a1