Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (13 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [193397] (3 PDB entries) |
Domain d4hr2a_: 4hr2 A: [202456] automated match to d4hr2b_ complexed with adp |
PDB Entry: 4hr2 (more details), 1.95 Å
SCOPe Domain Sequences for d4hr2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hr2a_ d.58.6.1 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]} smalertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhaerpf fkdlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgs dapetarveiafffpemnvysr
Timeline for d4hr2a_: