Lineage for d4hmza1 (4hmz A:1-196)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080920Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2080921Protein automated matches [190388] (23 species)
    not a true protein
  7. 2081059Species Streptomyces bikiniensis [TaxId:1896] [193359] (3 PDB entries)
  8. 2081064Domain d4hmza1: 4hmz A:1-196 [202447]
    Other proteins in same PDB: d4hmza2, d4hmzb2, d4hmzc2, d4hmzd2
    automated match to d4hmzb_
    complexed with 18t, edo

Details for d4hmza1

PDB Entry: 4hmz (more details), 2 Å

PDB Description: Crystal Structure of ChmJ, a 3'-monoepimerase from Streptomyces bikiniensis in complex with dTDP-quinovose
PDB Compounds: (A:) Putative 3-epimerase in D-allose pathway

SCOPe Domain Sequences for d4hmza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hmza1 b.82.1.0 (A:1-196) automated matches {Streptomyces bikiniensis [TaxId: 1896]}
mhplsiegawsqepvihsdhrgrshewfrgesfrqafghdfpvaqvnvavshrgalrgih
yteippgqakysvcvrgagldvvvdvrigsptfgrweivpmdaerntavyltaglgrafl
sltddatlvylcssgyaparehsvnpldpdlgiawpddiepllsdrdenaptlataerlg
llptyqawqeqqqaqr

SCOPe Domain Coordinates for d4hmza1:

Click to download the PDB-style file with coordinates for d4hmza1.
(The format of our PDB-style files is described here.)

Timeline for d4hmza1: