Lineage for d4hhmf_ (4hhm F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839096Protein D-xylose isomerase [51666] (13 species)
  7. 2839325Species Streptomyces sp. [TaxId:253732] [196714] (2 PDB entries)
  8. 2839333Domain d4hhmf_: 4hhm F: [202440]
    automated match to d4hhmg_
    complexed with co, mg; mutant

Details for d4hhmf_

PDB Entry: 4hhm (more details), 2.15 Å

PDB Description: crystal structure of a mutant, g219a, of glucose isomerase from streptomyces sp. sk
PDB Compounds: (F:) xylose isomerase

SCOPe Domain Sequences for d4hhmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhmf_ c.1.15.3 (F:) D-xylose isomerase {Streptomyces sp. [TaxId: 253732]}
nyqptpedrftfglwtvgwqgrdpfgdatrpaldpveavqrlaelgaygvtfhdddlipf
gasdtereahvkrfrqaldatgmtvpmattnlfthpvfkdgaftandrdvrryalrktir
nidlavelgakvyvawggregaesgaakdvraaldrmkeafdllgeyvtsqgydirfaie
pkpneprgdillptighalafierlerpelygvnpevaheqmaglnfphgiaqalwagkl
fhidlngqsgikydqdlrfgagdlraafwlvdllesagwegprhfdfkpprtedidgvwa
saagcmrnylilkeraaafradpevqealraarldqlaeptaadglqalladrtayedfd
vdaaaargmaferldqlamdhllgar

SCOPe Domain Coordinates for d4hhmf_:

Click to download the PDB-style file with coordinates for d4hhmf_.
(The format of our PDB-style files is described here.)

Timeline for d4hhmf_: