Lineage for d1bgxl1 (1bgx L:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354190Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (42 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2354193Domain d1bgxl1: 1bgx L:1-107 [20244]
    Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt3, d1bgxt4
    part of Fab TP7 against Taq DNA polymerase
    protein/DNA complex

Details for d1bgxl1

PDB Entry: 1bgx (more details), 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab
PDB Compounds: (L:) tp7 mab

SCOPe Domain Sequences for d1bgxl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bgxl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
diqmtqspaimsaspgekvtmtcsasssvsymywyqqkpgssprlliydstnlasgvpvr
fsgsgsgtsysltisrmeaedaatyycqqwstypltfgagtklelk

SCOPe Domain Coordinates for d1bgxl1:

Click to download the PDB-style file with coordinates for d1bgxl1.
(The format of our PDB-style files is described here.)

Timeline for d1bgxl1: