Lineage for d4hhhv_ (4hhh V:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1656663Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1656664Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1656665Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1656823Protein automated matches [190066] (5 species)
    not a true protein
  7. 1656892Species Pea (Pisum sativum) [TaxId:3888] [193409] (2 PDB entries)
  8. 1656900Domain d4hhhv_: 4hhh V: [202433]
    Other proteins in same PDB: d4hhha1, d4hhha2, d4hhhb1, d4hhhb2, d4hhhc1, d4hhhc2, d4hhhd1, d4hhhd2
    automated match to d4hhht_
    complexed with rub

Details for d4hhhv_

PDB Entry: 4hhh (more details), 2.2 Å

PDB Description: Structure of Pisum sativum Rubisco
PDB Compounds: (V:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d4hhhv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhhv_ d.73.1.1 (V:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mqvwppigkkkfetlsylppltrdqllkeveyllrkgwvpclefelkkgfvyrehnkspg
yydgrywtmwklpmfgttdpaqvlkeldevkkeyprafvrvigfnnvrqvqcisfiahtp
esy

SCOPe Domain Coordinates for d4hhhv_:

Click to download the PDB-style file with coordinates for d4hhhv_.
(The format of our PDB-style files is described here.)

Timeline for d4hhhv_: