SCOPe 2.04: Domain d4hhhd2: 4hhh D:150-469

Lineage for d4hhhd2 (4hhh D:150-469)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (5 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [226514] (2 PDB entries)

8. Domain d4hhhd2: 4hhh D:150-469 [202430]
   Other proteins in same PDB: d4hhha1, d4hhhb1, d4hhhc1, d4hhhd1, d4hhhs_, d4hhht_, d4hhhu_, d4hhhv_
   automated match to d1gk8a1
   complexed with rub

Details for d4hhhd2

PDB Entry: 4hhh, 2.2 Å

PDB Description: Structure of Pisum sativum Rubisco

PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4hhhd2:

Sequence; same for both SEQRES and ATOM records:

>d4hhhd2 c.1.14.1 (D:150-469) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfcaeaiyksqaetgeikghylnatagtceemlkravfarelgvpivmhdy
ltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhihag
tvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvslpgvipvasggihvwhmpa
lteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregnaiireac
kwspelaaacevwkeikfef

Timeline for d4hhhd2:

• d4hhhd2 first appeared in SCOPe 2.03
  
• d4hhhd2 appears in SCOPe 2.05
  
• d4hhhd2 appears in the current release, SCOPe 2.08